N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

Western Blot: N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) [NBP3-33260] - Western blot analysis of various lysates using N-Acetylmannosamine Kinase/GNE Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Western Blot: N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) [NBP3-33260] - Western blot analysis of lysates from Mouse liver, using N-Acetylmannosamine Kinase/GNE Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 5T9K10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) Summary

• Description: Novus Biologicals Rabbit N-Acetylmannosamine Kinase/GNE Antibody (5T9K10) (NBP3-33260) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 623-722 of human N-Acetylmannosamine Kinase/GNE (Q9Y223).
  
  Sequence:
  GALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GNE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for N-Acetylmannosamine Kinase/GNE Antibody (5T9K10)

• bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
• DMRV
• GLCNE
• GLCNENM
• glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
• GNE
• IBM2
• NAcetylmannosamine Kinase
• N-Acetylmannosamine Kinase
• N-acylmannosamine kinase
• Uae1
• UDP-GlcNAc-2-epimerase/ManAc kinase
• UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
• UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase

Background

The protein encoded by the GNE gene is a bifunctional enzyme that monitors and begins biosynthesis of N-acetylneuraminic acid (NeuAc). NeuAC is a precursor of sialic acids and functions in early development as sialylation is a component of cell adhesion, signal transduction, and tumorigencity and metastic behavior of malignant cells. The GNE gene has been linked to various diseases such as: myopathy, dementia, glomerulosclerosis, muscular dystrophy, and neuromuscular disease. This protein creates an enzyme that is rate-limiting in the sialic acid biosynthetic pathway as well as plays a role in amino and nucleotide sugar metabolism as well as CMP-N-acetylneuraminate biosynthesis in eukaryotes. The GNE gene is known to interact with genes CRMP1. ZBTB16, PIK3C2A, KIAA1549, and RIF1 to participate in these pathways. GNE exists is five isoforms: isoform 1: 722 amino acids long; 79 kDA; isoform 2: 753 amino acids long, 83 kDA; isoform 3: 681 amino acids long; 74 kDA; isoform 4: 648 amino acids long, 71 kDA; isoform 5: 612 amino acids long, 66 kDA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNE