![Immunocytochemistry/Immunofluorescence: smu1 Antibody [NBP1-88522] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/smu1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88522-img0006.jpg "Immunocytochemistry/Immunofluorescence: smu1 Antibody [NBP1-88522] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SIEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVDSIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVLELIELRELGAARSLLRQTDPMIML |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMU1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88522 | Applications | Species |
|---|---|---|
| Qian M, Zeng Q, Zhang C et al. SMU1 knockdown suppresses gastric carcinoma growth, migration, and invasion and modulates the G0/G1 checkpoint of the cell cycle Research Square 2023-09-06 (WB, IHC, Human) | WB, IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMU1 |
![Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/smu1-Antibody-Immunohistochemistry-Paraffin-NBP1-88522-img0012.jpg "Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human cerebral cortex shows strong granular positivity in cytoplasm in neurons.](http://images.novusbio.com/fullsize/smu1-Antibody-Immunohistochemistry-Paraffin-NBP1-88522-img0009.jpg "Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human cerebral cortex shows strong granular positivity in cytoplasm in neurons.")
![Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/smu1-Antibody-Immunohistochemistry-Paraffin-NBP1-88522-img0010.jpg "Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human prostate shows moderate granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/smu1-Antibody-Immunohistochemistry-Paraffin-NBP1-88522-img0011.jpg "Immunohistochemistry-Paraffin: smu1 Antibody [NBP1-88522] - Staining of human prostate shows moderate granular positivity in cytoplasm in glandular cells.")
![Western Blot: smu1 Antibody [NBP1-88522] - Analysis using Anti-SMU1 antibody NBP1-88522 (A) shows similar pattern to independent antibody NBP1-88521 (B).](http://images.novusbio.com/fullsize/smu1-Antibody-Western-Blot-NBP1-88522-img0008.jpg "Western Blot: smu1 Antibody [NBP1-88522] - Analysis using Anti-SMU1 antibody NBP1-88522 (A) shows similar pattern to independent antibody NBP1-88521 (B).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")