N-Acetyl-D-Glucosamine Kinase/NAGK Antibody

Images

 
Western Blot: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP1-89750] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP1-89750] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: N-Acetyl-D-Glucosamine Kinase/NAGK Antibody [NBP1-89750] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N-Acetyl-D-Glucosamine Kinase/NAGK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAGK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
N-Acetyl-D-Glucosamine Kinase/NAGK Protein (NBP1-89750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody

  • EC 2.7.1.59
  • GlcNAc Kinase
  • GNK
  • GNKGlcNAc kinase
  • N-acetyl-D-glucosamine kinase
  • N-Acetylglucosamine Kinase
  • N-acetylglucosamine kinaseHSA242910
  • NAGK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58283
Species: Hu
Applications: ICC/IF
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6717
Species: Hu
Applications: WB, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83842
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-15447
Species: Hu
Applications: WB
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28727
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750) (0)

There are no publications for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750) (0)

There are no reviews for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Acetyl-D-Glucosamine Kinase/NAGK Products

Bioinformatics Tool for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750)

Discover related pathways, diseases and genes to N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750)

Discover more about diseases related to N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750).
 

Pathways for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750)

View related products by pathway.

PTMs for N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750)

Learn more about PTMs related to N-Acetyl-D-Glucosamine Kinase/NAGK Antibody (NBP1-89750).

Blogs on N-Acetyl-D-Glucosamine Kinase/NAGK

There are no specific blogs for N-Acetyl-D-Glucosamine Kinase/NAGK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Acetyl-D-Glucosamine Kinase/NAGK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAGK
Entrez