N acetyl transferase 5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: N acetyl transferase 5 Antibody [NBP2-56635] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N acetyl transferase 5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Specificity
Specificity of human N acetyl transferase 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA20
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for N acetyl transferase 5 Antibody

  • dJ1002M8.1
  • dJ1175I6.2 (N-terminal acetyltransferase complex ard1 subunit)
  • EC 2.3.1.88
  • homolog)
  • N(alpha)-acetyltransferase 20, NatB catalytic subunit
  • N-acetyltransferase 3 homolog
  • N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae)
  • N-acetyltransferase 5 (GCN5-related, putative)
  • N-acetyltransferase 5
  • N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae
  • N-alpha-acetyltransferase 20, NatB catalytic subunit
  • NAT3N-terminal acetyltransferase B complex catalytic subunit NAT5
  • NAT5dJ1002M8.1 (N-terminal acetyltransferase complex ard1 subunit)
  • NatB complex subunit NAT5
  • N-terminal acetyltransferase B complex catalytic subunit NAA20
  • N-terminal acetyltransferase complex ARD1 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC
NBP1-60120
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, TCS
NBP1-85311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81010
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55172
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-85646
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-59401
Species: Hu, Po, Bv, Rb
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-56635
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for N acetyl transferase 5 Antibody (NBP2-56635) (0)

There are no publications for N acetyl transferase 5 Antibody (NBP2-56635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N acetyl transferase 5 Antibody (NBP2-56635) (0)

There are no reviews for N acetyl transferase 5 Antibody (NBP2-56635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for N acetyl transferase 5 Antibody (NBP2-56635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional N acetyl transferase 5 Products

Bioinformatics Tool for N acetyl transferase 5 Antibody (NBP2-56635)

Discover related pathways, diseases and genes to N acetyl transferase 5 Antibody (NBP2-56635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on N acetyl transferase 5

There are no specific blogs for N acetyl transferase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N acetyl transferase 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA20