MZF1 Antibody

Images

 
Western Blot: MZF1 Antibody [NBP1-82605] - Analysis in control (vector only transfected HEK293T lysate) and mZF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MZF1 Antibody [NBP1-82605] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: MZF1 Antibody [NBP1-82605] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MZF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MZF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MZF1 Protein (NBP1-82605PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MZF1 Antibody

  • myeloid zinc finger 1
  • MZF1B
  • MZF-1zinc finger protein 42 (myeloid-specific retinoic acid-responsive)
  • Zfp98
  • Zinc finger protein 42
  • ZNF42MZF
  • ZSCAN6Zinc finger and SCAN domain-containing protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4256
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-56092
Species: Hu
Applications: WB, ICC/IF
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for MZF1 Antibody (NBP1-82605) (0)

There are no publications for MZF1 Antibody (NBP1-82605).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MZF1 Antibody (NBP1-82605) (0)

There are no reviews for MZF1 Antibody (NBP1-82605). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MZF1 Antibody (NBP1-82605) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MZF1 Products

Bioinformatics Tool for MZF1 Antibody (NBP1-82605)

Discover related pathways, diseases and genes to MZF1 Antibody (NBP1-82605). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MZF1 Antibody (NBP1-82605)

Discover more about diseases related to MZF1 Antibody (NBP1-82605).
 

Pathways for MZF1 Antibody (NBP1-82605)

View related products by pathway.

PTMs for MZF1 Antibody (NBP1-82605)

Learn more about PTMs related to MZF1 Antibody (NBP1-82605).

Blogs on MZF1

There are no specific blogs for MZF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MZF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MZF1