Myozenin 2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Myozenin 2 Antibody [NBP1-88259] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & cytosol.

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human heart muscle, kidney, liver and prostate using Anti-MYOZ2 antibody NBP1-88259 (A) shows similar protein distribution across tissues to independent antibody NBP2-34020 (B).

Analysis in human heart muscle and prostate tissues using Anti-MYOZ2 antibody. Corresponding MYOZ2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human kidney.

Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human liver.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myozenin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myozenin 2 Antibody - BSA Free (NBP1-88259) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOZ2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Myozenin 2 Protein (NBP1-88259PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myozenin 2 Antibody - BSA Free

• C4orf5
• calcineurin-binding protein calsarcin-1
• calsarcin-1
• chromosome 4 open reading frame 5
• CS-1
• FATZ related protein 2
• FATZ-related protein 2
• muscle-specific protein
• myozenin 2
• myozenin-2

Background

Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYOZ2