Myozenin 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining in human heart muscle and prostate tissues using anti-MYOZ2 antibody. Corresponding MYOZ2 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human heart muscle, kidney, liver and prostate using Anti-MYOZ2 antibody NBP1-88259 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: Myozenin 2 Antibody [NBP1-88259] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human kidney.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Myozenin 2 Antibody [NBP1-88259] - Staining of human liver.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myozenin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPR
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOZ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myozenin 2 Protein (NBP1-88259PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myozenin 2 Antibody

  • C4orf5
  • calcineurin-binding protein calsarcin-1
  • calsarcin-1
  • chromosome 4 open reading frame 5
  • CS-1
  • FATZ related protein 2
  • FATZ-related protein 2
  • muscle-specific protein
  • myozenin 2
  • myozenin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-85439
Species: Hu, Mu
Applications: IHC, IHC-P, WB
BBA37
Species: Hu
Applications: AdBlk
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP2-16019
Species: Hu
Applications: IHC, IHC-P, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
6056-MC
Species: Hu
Applications: BA
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
201-LB/CF
Species: Hu
Applications: BA
MCC170
Species: Mu
Applications: ELISA
NBP1-88259
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Myozenin 2 Antibody (NBP1-88259) (0)

There are no publications for Myozenin 2 Antibody (NBP1-88259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myozenin 2 Antibody (NBP1-88259) (0)

There are no reviews for Myozenin 2 Antibody (NBP1-88259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myozenin 2 Antibody (NBP1-88259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myozenin 2 Products

Bioinformatics Tool for Myozenin 2 Antibody (NBP1-88259)

Discover related pathways, diseases and genes to Myozenin 2 Antibody (NBP1-88259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myozenin 2 Antibody (NBP1-88259)

Discover more about diseases related to Myozenin 2 Antibody (NBP1-88259).
 

Pathways for Myozenin 2 Antibody (NBP1-88259)

View related products by pathway.

Blogs on Myozenin 2

There are no specific blogs for Myozenin 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myozenin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOZ2