Myotilin Antibody - BSA Free

Western Blot: Myotilin Antibody [NBP2-87867] - WB Suggested Anti-MYOT Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Myotilin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Myotilin. Peptide sequence: RNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Myotilin Antibody - BSA Free

• 57 kDa cytoskeletal protein
• LGMD1A
• limb-girdle muscular dystrophy 1A (autosomal dominant)
• Myofibrillar titin-like Ig domains protein
• myotilin
• titin immunoglobulin domain protein (myotilin)
• Titin immunoglobulin domain protein
• TTIDLGMD1

Background

Striated muscle sarcomeres are highly organized structures composed of actin (thin) and myosin (thick) filaments that slide past each other during contraction. The integrity of sarcomeres is controlled by a set of structural proteins, among which are titin (TTN; MIM 188840), a giant molecule that contains several immunoglobulin (Ig)-like domains and associates with thin and thick filaments, and alpha-actinin (ACTN1; MIM 102575), an actin cross-linking protein. Mutations in several sarcomeric and sarcolemmal proteins have been shown to result in muscular dystrophy and cardiomyopathy.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYOT