Myosin IF Antibody

Images

 
Western Blot: Myosin IF Antibody [NBP2-83244] - Host: Rabbit. Target Name: MYO1F. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin IF Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Myosin IF. Peptide sequence: CIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MYO1F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin IF Antibody

  • myosin IF
  • myosin-ID
  • myosin-Ie
  • myosin-If

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92158
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87745
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00004642-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87739
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP1-93704
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-85546
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
AF3827
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-83244
Species: Hu
Applications: WB

Publications for Myosin IF Antibody (NBP2-83244) (0)

There are no publications for Myosin IF Antibody (NBP2-83244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin IF Antibody (NBP2-83244) (0)

There are no reviews for Myosin IF Antibody (NBP2-83244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin IF Antibody (NBP2-83244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin IF Products

Bioinformatics Tool for Myosin IF Antibody (NBP2-83244)

Discover related pathways, diseases and genes to Myosin IF Antibody (NBP2-83244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin IF Antibody (NBP2-83244)

Discover more about diseases related to Myosin IF Antibody (NBP2-83244).
 

Pathways for Myosin IF Antibody (NBP2-83244)

View related products by pathway.

Blogs on Myosin IF

There are no specific blogs for Myosin IF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin IF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1F