MYO1G Antibody - BSA Free

Western Blot: MYO1G Antibody [NBP1-93704] - Analysis in human lymph node tissue.

Immunohistochemistry-Paraffin: MYO1G Antibody [NBP1-93704] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: MYO1G Antibody [NBP1-93704] - Staining of human cerebral cortex shows low expression as expected.

Simple Western: MYO1G Antibody [NBP1-93704] - Simple Western lane view shows a specific band for MYO1G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: MYO1G Antibody [NBP1-93704] - Electropherogram image of the corresponding Simple Western lane view. MYO1G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Analysis in human lymph node tissue.

Analysis in human bone marrow and cerebral cortex tissues using Anti-MYO1G antibody. Corresponding MYO1G RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYO1G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MYO1G Antibody - BSA Free (NBP1-93704) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYO1G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Simple Western 1:25
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 lysate(s), separated by Size, antibody dilution of 1:25, apparent MW was 116 kDa.
• Control Peptide:

  MYO1G Protein (NBP1-93704PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYO1G Antibody - BSA Free

• HA2
• myosin IG
• myosin-Ig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYO1G