Myosin IF Antibody

Images

 
Immunohistochemistry: Myosin IF Antibody [NBP2-31598] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myosin IF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO1F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myosin IF Protein (NBP2-31598PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin IF Antibody

  • myosin IF
  • myosin-ID
  • myosin-Ie
  • myosin-If

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30661
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87739
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93704
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-98474
Species: Hu
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB600-230
Species: Hu
Applications: WB

Publications for Myosin IF Antibody (NBP2-31598) (0)

There are no publications for Myosin IF Antibody (NBP2-31598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin IF Antibody (NBP2-31598) (0)

There are no reviews for Myosin IF Antibody (NBP2-31598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Myosin IF Antibody (NBP2-31598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin IF Products

Myosin IF NBP2-31598

Bioinformatics Tool for Myosin IF Antibody (NBP2-31598)

Discover related pathways, diseases and genes to Myosin IF Antibody (NBP2-31598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin IF Antibody (NBP2-31598)

Discover more about diseases related to Myosin IF Antibody (NBP2-31598).
 

Pathways for Myosin IF Antibody (NBP2-31598)

View related products by pathway.

Blogs on Myosin IF

There are no specific blogs for Myosin IF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin IF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1F
Uniprot