Myosin heavy chain 11 Antibody (0O4O4)

Western Blot: Myosin heavy chain 11 Antibody (8A8J4) [NBP3-16323] - Western blot analysis of extracts of Mouse lung, using SMMHC/Myosin heavy chain 11 Rabbit mAb (NBP3-16323) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: Myosin heavy chain 11 Antibody (8A8J4) [NBP3-16323] - Western blot analysis of extracts of Rat lung, using SMMHC/Myosin heavy chain 11 Rabbit mAb (NBP3-16323) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Confocal imaging of paraffin-embedded Rat small intestine using Myosin heavy chain 11 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Confocal imaging of paraffin-embedded Human colon using Myosin heavy chain 11 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human lung tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 0O4O4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myosin heavy chain 11 Antibody (0O4O4) Summary

• Description: Novus Biologicals Rabbit Myosin heavy chain 11 Antibody (0O4O4) (NBP3-16323) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human Myosin heavy chain 11 (NP_002465.1). DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MYH11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:2000 - 1:10000
  • Immunohistochemistry-Paraffin 1:2000 - 1:10000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Myosin heavy chain 11 Antibody (0O4O4)

• AAT4
• FAA4
• MYH11 myosin, heavy chain 11, smooth muscle
• MYH11
• SMHC
• SMMHC
• Smooth muscle myosin heavy chain

Background

The protein encoded by the MYH11 gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. MYH11 functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. The pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript that encodes a protein consisting of the first 165 residues from the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH11