MYL7 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK |
| Predicted Species |
Mouse (94%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYL7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MYL7 Antibody - BSA Free
Background
Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for MYL7 Antibody (NBP1-81016) (0)
There are no publications for MYL7 Antibody (NBP1-81016).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYL7 Antibody (NBP1-81016) (0)
There are no reviews for MYL7 Antibody (NBP1-81016).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MYL7 Antibody (NBP1-81016) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MYL7 Products
Research Areas for MYL7 Antibody (NBP1-81016)
Find related products by research area.
|
Blogs on MYL7