Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1) Summary
Immunogen |
PFKM (NP_000280, 681 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV |
Specificity |
PFKM - phosphofructokinase, muscle (1D1) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PFKM |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1)
Background
The PFKM gene encodes the muscle isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. Mammalian PFK is a tetramer made up of various combinations of 3 subunits: muscle (PFKM), liver (PFKL; MIM 171860), and platelet (PFKP; MIM 171840), the genes for which are located on chromosomes 12q13, 21q22, and 10p, respectively. The composition of the tetramers differs according to the tissue type. Muscle and liver PFK are a homotetramers of 4M and 4L subunits, respectively. Erythrocytes contain both L and M subunits, which randomly tetramerize to form M4, L4, and M3L, M2L2, and ML3 hybrid forms of the holoenzyme (Vora et al., 1980 [PubMed 6444721]; Raben and Sherman, 1995 [PubMed 7550225]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Bv, Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)
There are no publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)
There are no reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Muscle Phosphofructokinase/PFKM/PFK-1 Products
Bioinformatics Tool for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)
Discover related pathways, diseases and genes to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)
Discover more about diseases related to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
| | Pathways for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)
View related products by pathway.
|
PTMs for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)
Learn more about PTMs related to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
| | Research Areas for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)
Find related products by research area.
|
Blogs on Muscle Phosphofructokinase/PFKM/PFK-1