Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1)

Images

 
Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1) [H00005213-M04] - Analysis of PFKM expression in K-562 (Cat # L009V1).
Sandwich ELISA: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1) [H00005213-M04] - Detection limit for recombinant GST tagged PFKM is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1) Summary

Immunogen
PFKM (NP_000280, 681 a.a. - 780 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
Specificity
PFKM - phosphofructokinase, muscle (1D1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PFKM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Control
Muscle Phosphofructokinase/PFKM/PFK-1 Lysate (NBP2-65463)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1)

  • 6-phosphofructokinase, muscle type
  • EC 2.7.1,6-phosphofructo-1-kinase
  • EC 2.7.1.11
  • GSD7
  • MGC8699
  • Muscle Phosphofructokinase
  • PFK1
  • PFK-1
  • PFKA
  • PFK-A
  • PFKM
  • PFKX
  • Phosphofructo-1-kinase isozyme A
  • Phosphofructokinase 1
  • phosphofructokinase, muscle
  • phosphofructokinase, polypeptide X
  • Phosphofructokinase-1
  • Phosphofructokinase-M
  • Phosphohexokinase

Background

The PFKM gene encodes the muscle isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. Mammalian PFK is a tetramer made up of various combinations of 3 subunits: muscle (PFKM), liver (PFKL; MIM 171860), and platelet (PFKP; MIM 171840), the genes for which are located on chromosomes 12q13, 21q22, and 10p, respectively. The composition of the tetramers differs according to the tissue type. Muscle and liver PFK are a homotetramers of 4M and 4L subunits, respectively. Erythrocytes contain both L and M subunits, which randomly tetramerize to form M4, L4, and M3L, M2L2, and ML3 hybrid forms of the holoenzyme (Vora et al., 1980 [PubMed 6444721]; Raben and Sherman, 1995 [PubMed 7550225]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005209-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16814
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45238
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)

There are no publications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)

There are no reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)

Discover related pathways, diseases and genes to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)

Discover more about diseases related to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
 

Pathways for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)

View related products by pathway.

PTMs for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)

Learn more about PTMs related to Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04).
 

Research Areas for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (H00005213-M04)

Find related products by research area.

Blogs on Muscle Phosphofructokinase/PFKM/PFK-1

There are no specific blogs for Muscle Phosphofructokinase/PFKM/PFK-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (1D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKM
Entrez
Uniprot