MURF3 Antibody - BSA Free

Western Blot: MURF3 Antibody [NBP1-52899] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MURF3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM54
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MURF3 Antibody - BSA Free

• MuRF
• muRF3
• MURF-3
• MURFtripartite motif-containing protein 54
• Muscle-specific RING finger protein 3
• Muscle-specific RING finger protein
• RING finger protein 30muscle-specific RING-finger protein 3
• RNF30
• tripartite motif containing 54
• tripartite motif-containing 54

Background

TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MURF3 Antibody (NBP1-52899) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 01/06/2017

Summary

• Application: Western Blot
• Sample Tested: C2C12 cell lysate
• Species: Mouse
• Lot: QC15651-90324

Comments

• Comments: Tissues or Cell Lines Tested: C2C12
  
  Subcellular Fraction: RIPA diluted in 1% proteinase inhibitor of PBS
  
  Concentration: 1 µg/µl
  
  Preparation:
  1. Perform a protein quantification assay (Bio-Red). Determine the protein concentration for each cell lysate.
  2. Determine how much protein to load and add an equal volume 2X Laemmli sample buffer.
  3. Boil each cell lysate in sample buffer at 100°C for 5 min.
  
  Controls: no positive control
  
  PAGE Gel: 10%
  
  PAGE Conditions: 60 volt for 1h, then 95 volt for 1-2h
  
  Membrane: PVDF 0.45µm
  
  Transfer Conditions: 35 volt, overnight
  
  Blocking Solution/ Duration: 5% milk in PBST for 1h at room temperature
  
  Primary Antibody Storage Conditions: -20C
  
  Reconstitution & Aliquot information: no
  
  Primary Antibody Diluent and Dilution: 1:500 in PBST contained 5% BSA
  
  Primary Antibody Incubation Time and Temperature: 4C overnight
  
  Wash Solution Composition, Repetitions & Times: PBST, three washes, 10 min each
  
  Secondary Antibody Manufacturer, Host Species: Jackson, anti-Rabbit-FRP
  
  Secondary Antibody Dilution, & Diluent: 1:4000 in PBST contained 5% milk
  
  Secondary Antibody Incubation Time & Temperature: 2h at room temperature
  
  Wash Solution Composition, Repetitions, & Times: PBST, three washes, 10 min each
  
  Detection Substrate: SuperSignal™ West Pico Chemiluminescent Substrate, catalog: 34080, Thermo
  
  Detection System, Procedure & Development Time: Acquire image using darkroom development techniques for chemiluminescence, development time: 5s
  
  Expected Molecular Weight: about 41 kDa
  
  Observed Molecular Weight: 48 kDa
  
  Controls: GAPDH
  
  Observations: 36 kDa

Bioinformatics

• Gene Symbol: TRIM54