MURF3 Antibody

Images

 
Western Blot: MURF3 Antibody [NBP1-52899] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MURF3 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM54
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRIM54 and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-52899 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MURF3 Antibody

  • MuRF
  • muRF3
  • MURF-3
  • MURFtripartite motif-containing protein 54
  • Muscle-specific RING finger protein 3
  • Muscle-specific RING finger protein
  • RING finger protein 30muscle-specific RING-finger protein 3
  • RNF30
  • tripartite motif containing 54
  • tripartite motif-containing 54

Background

TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31207
Species: Hu, Mu, Rt, Po, Sq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33691
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-76836
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-93304
Species: Hu, ChHa
Applications: WB, IP
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86609
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52899
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for MURF3 Antibody (NBP1-52899) (0)

There are no publications for MURF3 Antibody (NBP1-52899).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MURF3 Antibody (NBP1-52899) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-52899:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MURF3 NBP1-52899
Enlarge
5
reviewed by:
Anonymous
WB Mouse 01/06/2017
View

Summary

ApplicationWestern Blot
Sample TestedC2C12 cell lysate
SpeciesMouse
LotQC15651-90324

Comments

CommentsTissues or Cell Lines Tested: C2C12

Subcellular Fraction: RIPA diluted in 1% proteinase inhibitor of PBS

Concentration: 1 µg/µl

Preparation:
1. Perform a protein quantification assay (Bio-Red). Determine the protein concentration for each cell lysate.
2. Determine how much protein to load and add an equal volume 2X Laemmli sample buffer.
3. Boil each cell lysate in sample buffer at 100°C for 5 min.

Controls: no positive control

PAGE Gel: 10%

PAGE Conditions: 60 volt for 1h, then 95 volt for 1-2h

Membrane: PVDF 0.45µm

Transfer Conditions: 35 volt, overnight

Blocking Solution/ Duration: 5% milk in PBST for 1h at room temperature

Primary Antibody Storage Conditions: -20C

Reconstitution & Aliquot information: no

Primary Antibody Diluent and Dilution: 1:500 in PBST contained 5% BSA

Primary Antibody Incubation Time and Temperature: 4C overnight

Wash Solution Composition, Repetitions & Times: PBST, three washes, 10 min each

Secondary Antibody Manufacturer, Host Species: Jackson, anti-Rabbit-FRP

Secondary Antibody Dilution, & Diluent: 1:4000 in PBST contained 5% milk

Secondary Antibody Incubation Time & Temperature: 2h at room temperature

Wash Solution Composition, Repetitions, & Times: PBST, three washes, 10 min each

Detection Substrate: SuperSignal™ West Pico Chemiluminescent Substrate, catalog: 34080, Thermo

Detection System, Procedure & Development Time: Acquire image using darkroom development techniques for chemiluminescence, development time: 5s

Expected Molecular Weight: about 41 kDa

Observed Molecular Weight: 48 kDa

Controls: GAPDH

Observations: 36 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MURF3 Antibody (NBP1-52899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MURF3 Products

Bioinformatics Tool for MURF3 Antibody (NBP1-52899)

Discover related pathways, diseases and genes to MURF3 Antibody (NBP1-52899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MURF3 Antibody (NBP1-52899)

Discover more about diseases related to MURF3 Antibody (NBP1-52899).
 

Pathways for MURF3 Antibody (NBP1-52899)

View related products by pathway.

PTMs for MURF3 Antibody (NBP1-52899)

Learn more about PTMs related to MURF3 Antibody (NBP1-52899).
 

Research Areas for MURF3 Antibody (NBP1-52899)

Find related products by research area.

Blogs on MURF3

There are no specific blogs for MURF3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/06/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol TRIM54