MURF2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MURF2 Antibody [NBP1-92153] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MURF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MURF2 Antibody - BSA Free (NBP1-92153) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLGQIGPPGSEDSNVRKAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM55
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MURF2 Protein (NBP1-92153PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MURF2 Antibody - BSA Free

• muRF2
• MURF-2
• Muscle-specific RING finger protein 2
• RING finger protein 29muscle specific ring finger 2
• RNF29
• tripartite motif containing 55
• tripartite motif-containing 55
• tripartite motif-containing protein 55

Background

MURF2 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM55