MUC7 Antibody (7F2)

Images

 
ELISA: MUC7 Antibody (7F2) [H00004589-M06] - Detection limit for recombinant GST tagged MUC7 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, S-ELISA
Clone
7F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MUC7 Antibody (7F2) Summary

Immunogen
MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Specificity
mucin 7, salivary
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUC7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Functional
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004589-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC7 Antibody (7F2)

  • apo-MG2
  • DKFZp686J03256
  • FLJ27047
  • MG2MGC34772
  • MUC-7
  • mucin 7, secreted
  • mucin-7
  • Salivary mucin-7
  • salivary

Background

The MUC7 gene encodes a small salivary mucin, which is thought to function in a protective capacity by promoting the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing (Kirkbride et al., 2001 [PubMed 11378823]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC, IHC-P, IF
NBP2-47687
Species: Hu, Rt(-)
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB200-125
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, S-ELISA
NBP2-70481
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00004589-M06
Species: Hu
Applications: WB, ELISA, Func, S-ELISA

Publications for MUC7 Antibody (H00004589-M06)(1)

Reviews for MUC7 Antibody (H00004589-M06) (0)

There are no reviews for MUC7 Antibody (H00004589-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC7 Antibody (H00004589-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MUC7 Products

Bioinformatics Tool for MUC7 Antibody (H00004589-M06)

Discover related pathways, diseases and genes to MUC7 Antibody (H00004589-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC7 Antibody (H00004589-M06)

Discover more about diseases related to MUC7 Antibody (H00004589-M06).
 

Pathways for MUC7 Antibody (H00004589-M06)

View related products by pathway.

PTMs for MUC7 Antibody (H00004589-M06)

Learn more about PTMs related to MUC7 Antibody (H00004589-M06).

Blogs on MUC7

There are no specific blogs for MUC7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC7 Antibody (7F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC7
Entrez
OMIM
Uniprot