MUC7 Antibody (1C10)

Images

 
Sandwich ELISA: MUC7 Antibody (1C10) [H00004589-M05] - Detection limit for recombinant GST tagged MUC7 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MUC7 Antibody (1C10) Summary

Immunogen
MUC7 (NP_689504, 36 a.a. - 135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUC7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC7 Antibody (1C10)

  • apo-MG2
  • DKFZp686J03256
  • FLJ27047
  • MG2MGC34772
  • MUC-7
  • mucin 7, secreted
  • mucin-7
  • Salivary mucin-7
  • salivary

Background

The MUC7 gene encodes a small salivary mucin, which is thought to function in a protective capacity by promoting the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing (Kirkbride et al., 2001 [PubMed 11378823]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-44432
Species: Hu
Applications: Flow, IHC-P, PAGE, IF
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB200-124
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
MAB1296
Species: Hu
Applications: WB, IP
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00004589-M05
Species: Hu
Applications: WB, ELISA

Publications for MUC7 Antibody (H00004589-M05) (0)

There are no publications for MUC7 Antibody (H00004589-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC7 Antibody (H00004589-M05) (0)

There are no reviews for MUC7 Antibody (H00004589-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC7 Antibody (H00004589-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC7 Products

Bioinformatics Tool for MUC7 Antibody (H00004589-M05)

Discover related pathways, diseases and genes to MUC7 Antibody (H00004589-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC7 Antibody (H00004589-M05)

Discover more about diseases related to MUC7 Antibody (H00004589-M05).
 

Pathways for MUC7 Antibody (H00004589-M05)

View related products by pathway.

PTMs for MUC7 Antibody (H00004589-M05)

Learn more about PTMs related to MUC7 Antibody (H00004589-M05).

Blogs on MUC7

There are no specific blogs for MUC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC7 Antibody (1C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC7
Uniprot