MUC12 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC12. Source: E. coli
Amino Acid Sequence: EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MUC12 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82607. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MUC12 Recombinant Protein Antigen
Background
Human MUC12 (Mucin 12) is a novel mucin of epithelial mucins, which are large, secreted or cell surface glycoproteins involved in epithelial cell protection, adhesion modulation, and signaling. Using differential display on RNA from paired normal colonic mucosa and primary colorectal tumor, MUC12 is identified as one of the 2 partial cDNAs representing novel mucin genes as well as MUC11. They are downregulated in colorectal tumors.The deduced MUC12 protein contains a predicted transmembrane domain, 2 extracellular cysteine-rich EGF-like domains, a coiled-coil region, and a domain consisting of serine-, threonine-, and proline-rich degenerate tandem repeats of 28 amino acids, a structural feature typical of mucins. Human MUC12 shares high sequence homology with MUC3 and MUC4 . Northern blot analysis of 50 different normal tissues detected MUC12 expression in colon, pancreas, prostate, and uterus, with highest expression in colon. The MUC12 transcript is large, estimated to be longer than 12 kb. Expression of MUC12 was downregulated or absent in 6 of 15 (40%) colorectal tumors, as compared with matched normal colonic tissues. MUC12 expression was not detected in any of 6 colorectal cancer cell lines examined. Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC 12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC 12 is down-regulated in colorectal cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: AC
Publications for MUC12 Protein (NBP1-82607PEP) (0)
There are no publications for MUC12 Protein (NBP1-82607PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MUC12 Protein (NBP1-82607PEP) (0)
There are no reviews for MUC12 Protein (NBP1-82607PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MUC12 Protein (NBP1-82607PEP) (0)
Additional MUC12 Products
Research Areas for MUC12 Protein (NBP1-82607PEP)
Find related products by research area.
|
Blogs on MUC12