Recombinant Human MUC12 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related MUC12 Peptides and Proteins

Order Details


    • Catalog Number
      H00010071-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human MUC12 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-120 of Human MUC12

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GGNTTSASTPSSSDPFTTFSDYGVSVTFITGSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFPSHSATSVFVGEPKTSPITSASME

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MUC12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MUC12 GST (N-Term) Protein

  • MUC11
  • MUC-11
  • MUC-12
  • mucin 11
  • mucin 12, cell surface associated
  • mucin-11
  • mucin-12

Background

Human MUC12 (Mucin 12) is a novel mucin of epithelial mucins, which are large, secreted or cell surface glycoproteins involved in epithelial cell protection, adhesion modulation, and signaling. Using differential display on RNA from paired normal colonic mucosa and primary colorectal tumor, MUC12 is identified as one of the 2 partial cDNAs representing novel mucin genes as well as MUC11. They are downregulated in colorectal tumors.The deduced MUC12 protein contains a predicted transmembrane domain, 2 extracellular cysteine-rich EGF-like domains, a coiled-coil region, and a domain consisting of serine-, threonine-, and proline-rich degenerate tandem repeats of 28 amino acids, a structural feature typical of mucins. Human MUC12 shares high sequence homology with MUC3 and MUC4 . Northern blot analysis of 50 different normal tissues detected MUC12 expression in colon, pancreas, prostate, and uterus, with highest expression in colon. The MUC12 transcript is large, estimated to be longer than 12 kb. Expression of MUC12 was downregulated or absent in 6 of 15 (40%) colorectal tumors, as compared with matched normal colonic tissues. MUC12 expression was not detected in any of 6 colorectal cancer cell lines examined. Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC 12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC 12 is down-regulated in colorectal cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC,  IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91013
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, IP, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-82045
Species: Hu
Applications: IHC,  IHC-P
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
NBP2-24566
Species: Hu
Applications: IHC,  IHC-P, WB
5609-MU
Species: Hu
Applications: Bind
NBP3-17128
Species: Hu
Applications: IHC,  IHC-P
NBP1-76939
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-41928
Species: Hu
Applications: IHC,  IHC-P, WB
MAB8245
Species: Hu
Applications: IHC
NBP2-94455
Species: Hu, Mu, Rt
Applications: WB
H00010071-Q02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)

There are no publications for MUC12 Partial Recombinant Protein (H00010071-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)

There are no reviews for MUC12 Partial Recombinant Protein (H00010071-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MUC12 Products

Research Areas for MUC12 Partial Recombinant Protein (H00010071-Q02)

Find related products by research area.

Blogs on MUC12

There are no specific blogs for MUC12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MUC12 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC12