Recombinant Human MUC12 GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-120 of Human MUC12 Source: Wheat Germ (in vitro) Amino Acid Sequence: GGNTTSASTPSSSDPFTTFSDYGVSVTFITGSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFPSHSATSVFVGEPKTSPITSASME |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
MUC12 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
35.64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human MUC12 GST (N-Term) Protein
Background
Human MUC12 (Mucin 12) is a novel mucin of epithelial mucins, which are large, secreted or cell surface glycoproteins involved in epithelial cell protection, adhesion modulation, and signaling. Using differential display on RNA from paired normal colonic mucosa and primary colorectal tumor, MUC12 is identified as one of the 2 partial cDNAs representing novel mucin genes as well as MUC11. They are downregulated in colorectal tumors.The deduced MUC12 protein contains a predicted transmembrane domain, 2 extracellular cysteine-rich EGF-like domains, a coiled-coil region, and a domain consisting of serine-, threonine-, and proline-rich degenerate tandem repeats of 28 amino acids, a structural feature typical of mucins. Human MUC12 shares high sequence homology with MUC3 and MUC4 . Northern blot analysis of 50 different normal tissues detected MUC12 expression in colon, pancreas, prostate, and uterus, with highest expression in colon. The MUC12 transcript is large, estimated to be longer than 12 kb. Expression of MUC12 was downregulated or absent in 6 of 15 (40%) colorectal tumors, as compared with matched normal colonic tissues. MUC12 expression was not detected in any of 6 colorectal cancer cell lines examined. Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC 12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC 12 is down-regulated in colorectal cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)
There are no publications for MUC12 Partial Recombinant Protein (H00010071-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)
There are no reviews for MUC12 Partial Recombinant Protein (H00010071-Q02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MUC12 Partial Recombinant Protein (H00010071-Q02) (0)
Additional MUC12 Products
Research Areas for MUC12 Partial Recombinant Protein (H00010071-Q02)
Find related products by research area.
|
Blogs on MUC12