![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Analysis in human cererbral cortex and pancreas tissues. Corresponding CRYM RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0012.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Analysis in human cererbral cortex and pancreas tissues. Corresponding CRYM RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRE |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRYM |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for mu Crystallin Antibody (NBP2-55172)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRYM |
![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex, kidney, pancreas and prostate using Anti-mu Crystallin antibody NBP2-55172 (A) shows similar protein distribution across tissues to independent antibody NBP1-85241 (B).](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0019.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex, kidney, pancreas and prostate using Anti-mu Crystallin antibody NBP2-55172 (A) shows similar protein distribution across tissues to independent antibody NBP1-85241 (B).")
![Immunocytochemistry/Immunofluorescence: mu Crystallin Antibody [NBP2-55172] - Staining of human cell line SH-SY5Y shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55172-img0007.jpg "Immunocytochemistry/Immunofluorescence: mu Crystallin Antibody [NBP2-55172] - Staining of human cell line SH-SY5Y shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0020.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0015.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human pancreas shows low postivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0016.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human pancreas shows low postivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/mu-Crystallin-Antibody-Immunohistochemistry-Paraffin-NBP2-55172-img0018.jpg "Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Western_Blot_13010.jpg)
![Immunohistochemistry Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Immunohistochemistry_14734.jpg)
![ELISA Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/af7947_human-mouse-rat-neurogranin-affinity-purified-polyclonal-ab-elisa-27102022104024.jpg)
![Western Blot Integrin alpha 11 Antibody (396214) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_11_MAB4235_Western_Blot_7096.jpg)
![Western Blot Integrin alpha 11 Antibody (396214) [Unconjugated]](https://images.novusbio.com/images/mab4235_human-mouse-integrin-alpha-11-mab-clone-396214-4120241251488.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")