MTUS1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MTUS1 Antibody [NBP2-57208] - Staining of human cell line A549 shows localization to nucleoli & microtubules.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTUS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTUS1 Antibody - BSA Free (NBP2-57208) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGKVTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDECPLMVPAFDKSEAQVLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTUS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MTUS1 Recombinant Protein Antigen (NBP2-57208PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MTUS1 Antibody - BSA Free

• Angiotensin-II type 2 receptor-interacting protein
• AT2 receptor-binding protein
• AT2R binding protein
• ATBPATIP1
• ATIP
• DKFZp586D1519
• erythroid differentiation-related
• FLJ14295
• GK1
• KIAA1288DKFZp686F20243
• microtubule associated tumor suppressor 1
• microtubule-associated tumor suppressor 1
• Mitochondrial tumor suppressor 1
• mitochondrial tumor suppressor gene 1
• MP44
• MTSG1AT2 receptor-interacting protein
• transcription factor MTSG1

Background

MTUS1 encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTUS1