MTUS1 Antibody - BSA Free

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: MTUS1 Antibody [NBP1-60099] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Western Blot: MTUS1 Antibody [NBP1-60099] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MTUS1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTUS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MTUS1 Antibody - BSA Free

• Angiotensin-II type 2 receptor-interacting protein
• AT2 receptor-binding protein
• AT2R binding protein
• ATBPATIP1
• ATIP
• DKFZp586D1519
• erythroid differentiation-related
• FLJ14295
• GK1
• KIAA1288DKFZp686F20243
• microtubule associated tumor suppressor 1
• microtubule-associated tumor suppressor 1
• Mitochondrial tumor suppressor 1
• mitochondrial tumor suppressor gene 1
• MP44
• MTSG1AT2 receptor-interacting protein
• transcription factor MTSG1

Background

MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTUS1
• Uniprot:
  • Q9ULD2(Human)