MTUS1 Antibody

Images

 
Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: MTUS1 Antibody [NBP1-60099] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes Primary ...read more
Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Western Blot: MTUS1 Antibody [NBP1-60099] - MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Western Blot: MTUS1 Antibody [NBP1-60099] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2
Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: MTUS1 Antibody [NBP1-60099] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTUS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTUS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against MTUS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTUS1 Antibody

  • Angiotensin-II type 2 receptor-interacting protein
  • AT2 receptor-binding protein
  • AT2R binding protein
  • ATBPATIP1
  • ATIP
  • DKFZp586D1519
  • erythroid differentiation-related
  • FLJ14295
  • GK1
  • KIAA1288DKFZp686F20243
  • microtubule associated tumor suppressor 1
  • microtubule-associated tumor suppressor 1
  • Mitochondrial tumor suppressor 1
  • mitochondrial tumor suppressor gene 1
  • MP44
  • MTSG1AT2 receptor-interacting protein
  • transcription factor MTSG1

Background

MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-60099
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for MTUS1 Antibody (NBP1-60099) (0)

There are no publications for MTUS1 Antibody (NBP1-60099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTUS1 Antibody (NBP1-60099) (0)

There are no reviews for MTUS1 Antibody (NBP1-60099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTUS1 Antibody (NBP1-60099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTUS1 Products

Bioinformatics Tool for MTUS1 Antibody (NBP1-60099)

Discover related pathways, diseases and genes to MTUS1 Antibody (NBP1-60099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTUS1 Antibody (NBP1-60099)

Discover more about diseases related to MTUS1 Antibody (NBP1-60099).
 

Pathways for MTUS1 Antibody (NBP1-60099)

View related products by pathway.

PTMs for MTUS1 Antibody (NBP1-60099)

Learn more about PTMs related to MTUS1 Antibody (NBP1-60099).
 

Research Areas for MTUS1 Antibody (NBP1-60099)

Find related products by research area.

Blogs on MTUS1

There are no specific blogs for MTUS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTUS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTUS1
Uniprot