mtTFA Antibody Summary
Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
TFAM (NP_003192.1, 1 a.a. - 246 a.a.) full-length human protein. MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Specificity
TFAM - transcription factor A, mitochondrial,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TFAM
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Applications/Dilutions
Dilutions
Immunocytochemistry/ Immunofluorescence Immunohistochemistry Immunohistochemistry-Paraffin Western Blot
Application Notes
Antibody reactivity against tissue lystae and transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00007019-B01P in the following applications:
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for mtTFA Antibody
Background
TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
Publications for mtTFA Antibody (H00007019-B01P)(11)
We have publications tested in 1 confirmed species: Mouse.
We have publications tested in 2 applications: ICC/IF, WB.
Submit a Publication
Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 -
10 of 11.
Show All 11 Publications.
Collapse Publications.
Publications using H00007019-B01P
Applications
Species
Shin J, Hong S, Choi S et al. Flow-induced endothelial mitochondrial remodeling mitigates mitochondrial reactive oxygen species production and promotes mitochondrial DNA integrity in a p53-dependent manner Redox Biology 2022-04-01 [PMID: 35121402] (ICC/IF, WB, Mouse)
ICC/IF, WB
Mouse
Morishita M, Kawamoto T, Hara H et al. AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway. Int J Oncol 2017-01-01 [PMID: 27878239]
Takeda D, Hasegawa T, Ueha T et al. Decreased mitochondrial copy numbers in oral squamous cell carcinoma. Head Neck 2016-04-15 [PMID: 27079936]
Akbari M, Sykora P, Bohr VA. Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells. Sci Rep. 2015-08-10 [PMID: 26256098]
Gibellini L, Pinti M, Boraldi F et al. Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells. FASEB J. 2014-08-25 [PMID: 25154874]
Akbari M, Keijzers G, Maynard S et al. Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair. DNA Repair (Amst). 2014-02-27 [PMID: 24674627]
Rolland SG, Motori E, Memar N et al. Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion. Proc Natl Acad Sci U S A. 2013-08-06 [PMID: 23878239]
Gispert S, Parganlija D, Klinkenberg M et al. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA, and inflammatory factors. Hum Mol Genet. 2013-07-12 [PMID: 23851121]
Holmstrom MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM. Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes. Am J Physiol Endocrinol Metab. 2012-01-17 [PMID: 22252943]
Balliet RM, Capparelli C, Guido C et al. Mitochondrial oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast cancer tumor growth: understanding the aging and cancer connection. Cell Cycle 2011-12-01 [PMID: 22129993]
Aamann MD, Sorensen MM, Hvitby C et al. Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane. FASEB J. 2010-02-24 [PMID: 20181933]
Show All 11 Publications.
Collapse Publications.
Reviews for mtTFA Antibody (H00007019-B01P) (0)
There are no reviews for mtTFA Antibody (H00007019-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for mtTFA Antibody (H00007019-B01P) (0)
Secondary Antibodies
Isotype Controls
Additional mtTFA Products
Research Areas for mtTFA Antibody (H00007019-B01P)
Find related products by research area.
Blogs on mtTFA