We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

mtTFA Antibody

Images

 
Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in human kidney.
Immunocytochemistry/ Immunofluorescence: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)
Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in transfected 293T cell line by TFAM polyclonal antibody. Lane 1: TFAM transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related mtTFA Primary Antibodies

Order Details


    • Catalog Number
      H00007019-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

mtTFA Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
TFAM (NP_003192.1, 1 a.a. - 246 a.a.) full-length human protein. MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Specificity
TFAM - transcription factor A, mitochondrial,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TFAM
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Antibody reactivity against tissue lystae and transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00007019-B01P in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mtTFA Antibody

  • mitochondrial transcription factor A
  • MtTF1
  • mtTFA
  • TCF-6
  • TCF6L1
  • TCF6L2Mitochondrial transcription factor 1
  • TCF6TCF6L3
  • Transcription factor 6
  • Transcription factor 6-like 2 (mitochondrial transcription factor)
  • Transcription factor 6-like 2
  • transcription factor A, mitochondrial

Background

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19586
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB5306
Species: Hu, Mu, Rt
Applications: WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78283
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-13429
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
H00007019-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for mtTFA Antibody (H00007019-B01P)(11)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00007019-B01P Applications Species
Shin J, Hong S, Choi S et al. Flow-induced endothelial mitochondrial remodeling mitigates mitochondrial reactive oxygen species production and promotes mitochondrial DNA integrity in a p53-dependent manner Redox Biology 2022-04-01 [PMID: 35121402] (ICC/IF, WB, Mouse) ICC/IF, WB Mouse
Morishita M, Kawamoto T, Hara H et al. AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway. Int J Oncol 2017-01-01 [PMID: 27878239]
Takeda D, Hasegawa T, Ueha T et al. Decreased mitochondrial copy numbers in oral squamous cell carcinoma. Head Neck 2016-04-15 [PMID: 27079936]
Akbari M, Sykora P, Bohr VA. Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells. Sci Rep. 2015-08-10 [PMID: 26256098]
Gibellini L, Pinti M, Boraldi F et al. Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells. FASEB J. 2014-08-25 [PMID: 25154874]
Akbari M, Keijzers G, Maynard S et al. Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair. DNA Repair (Amst). 2014-02-27 [PMID: 24674627]
Rolland SG, Motori E, Memar N et al. Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion. Proc Natl Acad Sci U S A. 2013-08-06 [PMID: 23878239]
Gispert S, Parganlija D, Klinkenberg M et al. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA, and inflammatory factors. Hum Mol Genet. 2013-07-12 [PMID: 23851121]
Holmstrom MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM. Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes. Am J Physiol Endocrinol Metab. 2012-01-17 [PMID: 22252943]
Balliet RM, Capparelli C, Guido C et al. Mitochondrial oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast cancer tumor growth: understanding the aging and cancer connection. Cell Cycle 2011-12-01 [PMID: 22129993]
Show All 11 Publications.

Reviews for mtTFA Antibody (H00007019-B01P) (0)

There are no reviews for mtTFA Antibody (H00007019-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for mtTFA Antibody (H00007019-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mtTFA Products

Research Areas for mtTFA Antibody (H00007019-B01P)

Find related products by research area.

Blogs on mtTFA

There are no specific blogs for mtTFA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mtTFA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAM
Entrez
Uniprot