mtTFA Antibody

Images

 
Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in human kidney.
Immunocytochemistry/ Immunofluorescence: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)
Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in transfected 293T cell line by TFAM polyclonal antibody. Lane 1: TFAM transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

mtTFA Antibody Summary

Immunogen
TFAM (NP_003192.1, 1 a.a. - 246 a.a.) full-length human protein. MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Specificity
TFAM - transcription factor A, mitochondrial,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TFAM
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against tissue lystae and transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00007019-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mtTFA Antibody

  • mitochondrial transcription factor A
  • MtTF1
  • mtTFA
  • TCF-6
  • TCF6L1
  • TCF6L2Mitochondrial transcription factor 1
  • TCF6TCF6L3
  • Transcription factor 6
  • Transcription factor 6-like 2 (mitochondrial transcription factor)
  • Transcription factor 6-like 2
  • transcription factor A, mitochondrial

Background

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13429
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00007019-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for mtTFA Antibody (H00007019-B01P)(10)


Showing Publications 1 - 10 of 10.
Publications using H00007019-B01P Applications Species
Morishita M, Kawamoto T, Hara H et al. AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway. Int J Oncol 2017 Jan [PMID: 27878239]
Takeda D, Hasegawa T, Ueha T et al. Decreased mitochondrial copy numbers in oral squamous cell carcinoma. Head Neck 2016 Apr 15 [PMID: 27079936]
Akbari M, Sykora P, Bohr VA. Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells. Sci Rep. 2015 Aug 10 [PMID: 26256098]
Gibellini L, Pinti M, Boraldi F et al. Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells. FASEB J. 2014 Aug 25 [PMID: 25154874]
Akbari M, Keijzers G, Maynard S et al. Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair. DNA Repair (Amst). 2014 Feb 27 [PMID: 24674627]
Rolland SG, Motori E, Memar N et al. Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion. Proc Natl Acad Sci U S A. 2013 Aug 6 [PMID: 23878239]
Gispert S, Parganlija D, Klinkenberg M et al. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA, and inflammatory factors. Hum Mol Genet. 2013 Jul 12 [PMID: 23851121]
Holmstrom MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM. Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes. Am J Physiol Endocrinol Metab. 2012 Jan 17 [PMID: 22252943]
Balliet RM, Capparelli C, Guido C et al. Mitochondrial oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast cancer tumor growth: understanding the aging and cancer connection. Cell Cycle 2011 Dec 1 [PMID: 22129993]
Aamann MD, Sorensen MM, Hvitby C et al. Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane. FASEB J. 2010 Feb 24. [PMID: 20181933]

Reviews for mtTFA Antibody (H00007019-B01P) (0)

There are no reviews for mtTFA Antibody (H00007019-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for mtTFA Antibody (H00007019-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mtTFA Products

Bioinformatics Tool for mtTFA Antibody (H00007019-B01P)

Discover related pathways, diseases and genes to mtTFA Antibody (H00007019-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mtTFA Antibody (H00007019-B01P)

Discover more about diseases related to mtTFA Antibody (H00007019-B01P).
 

Pathways for mtTFA Antibody (H00007019-B01P)

View related products by pathway.

PTMs for mtTFA Antibody (H00007019-B01P)

Learn more about PTMs related to mtTFA Antibody (H00007019-B01P).
 

Research Areas for mtTFA Antibody (H00007019-B01P)

Find related products by research area.

Blogs on mtTFA

There are no specific blogs for mtTFA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mtTFA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAM
Entrez
Uniprot