mtTFA Antibody

Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in human kidney.

Immunocytochemistry/Immunofluorescence: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on HeLa cell. (antibody concentration 10 ug/ml)

Immunohistochemistry-Paraffin: mtTFA Antibody [H00007019-B01P] - Analysis of purified antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)

Western Blot: mtTFA Antibody [H00007019-B01P] - Analysis of TFAM expression in transfected 293T cell line by TFAM polyclonal antibody. Lane 1: TFAM transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

mtTFA Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TFAM (NP_003192.1, 1 a.a. - 246 a.a.) full-length human protein. MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
• Specificity: TFAM - transcription factor A, mitochondrial,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TFAM
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against tissue lystae and transfected lysate for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mtTFA Antibody

• mitochondrial transcription factor A
• MtTF1
• mtTFA
• TCF-6
• TCF6L1
• TCF6L2Mitochondrial transcription factor 1
• TCF6TCF6L3
• Transcription factor 6
• Transcription factor 6-like 2 (mitochondrial transcription factor)
• Transcription factor 6-like 2
• transcription factor A, mitochondrial

Background

TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mtTFA Antibody (H00007019-B01P)(11)

Publications using H00007019-B01P

• Shin J, Hong S, Choi S et al. Flow-induced endothelial mitochondrial remodeling mitigates mitochondrial reactive oxygen species production and promotes mitochondrial DNA integrity in a p53-dependent manner Redox Biology 2022-04-01 [PMID: 35121402] (ICC/IF, WB, Mouse)
• Morishita M, Kawamoto T, Hara H et al. AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway. Int J Oncol 2017-01-01 [PMID: 27878239]
• Takeda D, Hasegawa T, Ueha T et al. Decreased mitochondrial copy numbers in oral squamous cell carcinoma. Head Neck 2016-04-15 [PMID: 27079936]
• Akbari M, Sykora P, Bohr VA. Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells. Sci Rep. 2015-08-10 [PMID: 26256098]
• Gibellini L, Pinti M, Boraldi F et al. Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells. FASEB J. 2014-08-25 [PMID: 25154874]
• Akbari M, Keijzers G, Maynard S et al. Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair. DNA Repair (Amst). 2014-02-27 [PMID: 24674627]
• Rolland SG, Motori E, Memar N et al. Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion. Proc Natl Acad Sci U S A. 2013-08-06 [PMID: 23878239]
• Gispert S, Parganlija D, Klinkenberg M et al. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA, and inflammatory factors. Hum Mol Genet. 2013-07-12 [PMID: 23851121]
• Holmstrom MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM. Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes. Am J Physiol Endocrinol Metab. 2012-01-17 [PMID: 22252943]
• Balliet RM, Capparelli C, Guido C et al. Mitochondrial oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast cancer tumor growth: understanding the aging and cancer connection. Cell Cycle 2011-12-01 [PMID: 22129993]
• Aamann MD, Sorensen MM, Hvitby C et al. Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane. FASEB J. 2010-02-24 [PMID: 20181933]

Bioinformatics

• Gene Symbol: TFAM
• Entrez:
  • 7019(Human)
• Uniprot:
  • NP_003192.1(Human)