MTRR Antibody

Images

 
Immunohistochemistry-Paraffin: MTRR Antibody [NBP1-86596] - staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTRR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTRR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTRR Protein (NBP1-86596PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTRR Antibody

  • [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
  • 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
  • cblE
  • EC 1.16.1.8
  • methionine synthase reductase
  • methionine synthase reductase, mitochondrial
  • MGC129643
  • MSR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-71693
Species: Hu
Applications: WB, ICC/IF
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for MTRR Antibody (NBP1-86596) (0)

There are no publications for MTRR Antibody (NBP1-86596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTRR Antibody (NBP1-86596) (0)

There are no reviews for MTRR Antibody (NBP1-86596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTRR Antibody (NBP1-86596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTRR Products

Bioinformatics Tool for MTRR Antibody (NBP1-86596)

Discover related pathways, diseases and genes to MTRR Antibody (NBP1-86596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTRR Antibody (NBP1-86596)

Discover more about diseases related to MTRR Antibody (NBP1-86596).
 

Pathways for MTRR Antibody (NBP1-86596)

View related products by pathway.

PTMs for MTRR Antibody (NBP1-86596)

Learn more about PTMs related to MTRR Antibody (NBP1-86596).

Blogs on MTRR

There are no specific blogs for MTRR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTRR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTRR