MTF1 Antibody - BSA Free

Western Blot: MTF1 Antibody [NBP1-86379] - Analysis in control (vector only transfected HEK293T lysate) and MTF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: MTF1 Antibody [NBP1-86379] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: MTF1 Antibody [NBP1-86379] - Staining of human endometrium shows weak positivity in nuclear membrane in glandular cells.

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

ChIP-Exo-Seq composite graph for Anti-MTF1 (NBP1-86379) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTF1 Antibody - BSA Free (NBP1-86379) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MTF1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVK
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MTF1 Protein (NBP1-86379PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MTF1 Antibody - BSA Free

• metal regulatory transcription factor 1
• metal-regulatory transcription factor 1
• metal-responsive transcription factor 1
• MGC23036
• MRE-binding transcription factor
• MRE-binding transcription factor-1
• MTF-1
• Transcription factor MTF-1
• zinc regulatory factor
• ZRF

Background

MTF1 encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTF1 Antibody (NBP1-86379)(1)

Publication using NBP1-86379

• Doboszewska U, Soca?a K, Pieróg M et al. TC-G 1008 facilitates epileptogenesis by acting selectively at the GPR39 receptor but non-selectively activates CREB in the hippocampus of pentylenetetrazole-kindled mice Cellular and Molecular Life Sciences 2023-05-01 [PMID: 37185787]

Bioinformatics

• Gene Symbol: MTF1