MTA1 Antibody

Western Blot: MTA1 Antibody [H00009112-D01P] - Analysis of MTA1 expression in transfected 293T cell line by MTA1 polyclonal antibody.Lane 1: MTA1 transfected lysate(28.7 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: MTA1 Antibody [H00009112-D01P] - Analysis of antibody to MTA1 on HeLa cell. Antibody concentration 30 ug/ml.

Product Discontinued

MTA1 Antibody Summary

• Immunogen: MTA1 (AAH06177.1, 1 a.a. - 255 a.a.) full-length human protein. MKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED
• Specificity: Reacts with metastasis associated 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTA1 Antibody

• metastasis associated 1
• metastasis associated gene 1 protein
• metastasis associated protein
• metastasis-associated protein MTA1

Background

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for MTA1 Antibody (H00009112-D01P). (Showing 1 - 1 of 1 FAQ).

1. It says full length protein for H00009112-D01P but it also says aa1-200? But this protein is over 600aa long. What is this antibody to? Also, I am looking for an MTA1 antibody to N-terminus end prior to aa.338. Is this a possibility? Is this the only one?
   • H00009112-D01P was produced using an old accession number that was what was known as the full length protein at the time. It now corresponds to a portion of the protein but still recognizes it.

Bioinformatics

• Gene Symbol: MTA1
• Entrez:
  • 9112(Human)
• Uniprot:
  • AAH06177.1(Human)