MT-CO2 Antibody (6H0N5)

Western Blot: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Western blot analysis of extracts of various cell lines, using MT-CO2 Rabbit mAb (NBP3-16283) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Human liver tissue using MTCO2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Human brain tissue using MTCO2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: MT-CO2 Antibody (6H0N5) [NBP3-16283] -Confocal imaging of paraffin-embedded Human liver tissue using MTCO2 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry- MT-CO2 Antibody (6H0N5) [NBP3-16283] -Confocal imaging of HeLa cells using MTCO2 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Immunohistochemistry analysis of paraffin-embedded Human brain tissue using MT-CO2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Confocal imaging of paraffin-embedded Human liver tissue using MT-CO2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody (6H0N5) [NBP3-16283] - Confocal imaging of HeLa cells using MT-CO2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody (6H0N5) [MT-CO2] - Confocal imaging of paraffin-embedded Human liver tissue using MT-CO2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody (6H0N5) [MT-CO2] - Confocal imaging of HeLa cells using MT-CO2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6H0N5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MT-CO2 Antibody (6H0N5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 128-227 of human MT-CO2 (P00403). LEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: COX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MT-CO2 Antibody (6H0N5)

• COII
• COX2
• COXII
• Cytochrome C Oxidase II
• Cytochrome C Oxidase Polypeptide II
• Cytochrome C Oxidase Subunit II
• EC 1.9.3.1
• Mitochondrially Encoded Cytochrome C Oxidase II
• MTCO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX2