MSP/MST1 Antibody


Immunohistochemistry-Paraffin: MSP/MST1 Antibody [NBP1-85330] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes and plasma.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MSP/MST1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP
Specificity of human MSP/MST1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MSP/MST1 Protein (NBP1-85330PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MSP/MST1 Antibody

  • D3F15S2
  • EC 3.4.21
  • hepatocyte growth factor-like protein homolog
  • HGFL
  • HGFLhepatocyte growth factor-like protein
  • macrophage stimulating 1 (hepatocyte growth factor-like)
  • Macrophage stimulatory protein
  • Macrophage-stimulating protein
  • MSP
  • MSPDNF15S2
  • MST1
  • NF15S2
  • SF2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP, Block
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for MSP/MST1 Antibody (NBP1-85330) (0)

There are no publications for MSP/MST1 Antibody (NBP1-85330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSP/MST1 Antibody (NBP1-85330) (0)

There are no reviews for MSP/MST1 Antibody (NBP1-85330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MSP/MST1 Antibody (NBP1-85330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MSP/MST1 Products

Bioinformatics Tool for MSP/MST1 Antibody (NBP1-85330)

Discover related pathways, diseases and genes to MSP/MST1 Antibody (NBP1-85330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSP/MST1 Antibody (NBP1-85330)

Discover more about diseases related to MSP/MST1 Antibody (NBP1-85330).

Pathways for MSP/MST1 Antibody (NBP1-85330)

View related products by pathway.

PTMs for MSP/MST1 Antibody (NBP1-85330)

Learn more about PTMs related to MSP/MST1 Antibody (NBP1-85330).

Research Areas for MSP/MST1 Antibody (NBP1-85330)

Find related products by research area.

Blogs on MSP/MST1

There are no specific blogs for MSP/MST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MSP/MST1 Antibody and receive a gift card or discount.


Gene Symbol MST1