MSK2 Antibody

Images

 
Western Blot: MSK2 Antibody [NBP1-87844] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-359
Immunocytochemistry/ Immunofluorescence: MSK2 Antibody [NBP1-87844] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MSK2 Antibody [NBP1-87844] - Staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQGSFSVC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MSK2 Protein (NBP1-87844PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSK2 Antibody

  • MSK2
  • ribosomal protein S6 kinase, 90kDa, polypeptide 4
  • RPS6KA4
  • RSKB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2518
Species: Hu, Mu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MSK2 Antibody (NBP1-87844) (0)

There are no publications for MSK2 Antibody (NBP1-87844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSK2 Antibody (NBP1-87844) (0)

There are no reviews for MSK2 Antibody (NBP1-87844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MSK2 Antibody (NBP1-87844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSK2 Products

Bioinformatics Tool for MSK2 Antibody (NBP1-87844)

Discover related pathways, diseases and genes to MSK2 Antibody (NBP1-87844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSK2 Antibody (NBP1-87844)

Discover more about diseases related to MSK2 Antibody (NBP1-87844).
 

Pathways for MSK2 Antibody (NBP1-87844)

View related products by pathway.

PTMs for MSK2 Antibody (NBP1-87844)

Learn more about PTMs related to MSK2 Antibody (NBP1-87844).
 

Research Areas for MSK2 Antibody (NBP1-87844)

Find related products by research area.

Blogs on MSK2

There are no specific blogs for MSK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA4
Entrez