MS4A8B Antibody - BSA Free

Western Blot: MS4A8B Antibody [NBP3-35124] - Western blot analysis of lysates from U-87MG cells, using MS4A8B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MS4A8B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MS4A8B Antibody - BSA Free (NBP3-35124) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1).
  
  Sequence:
  SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MS4A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MS4A8B Antibody - BSA Free

• 4SPAN4
• Four-span transmembrane protein 4
• membrane-spanning 4-domains subfamily A member 8B
• membrane-spanning 4-domains, subfamily A, member 8B
• MS4A4
• MS4A8B

Background

Membrane-spanning 4-domains, subfamily A, member 8B (MS4A8B) is involved in signal transduction as a component of a multimeric receptor complex. MS4A8B is integral to membrane and receptor activity. The MS4A family has common structural features, similar intron/exon splice boundaries, and display unique expression patterns among hematopoietic cells and non-lymphoid tissues. MS4A8B is regulated by HNF4A and TGFB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MS4A8