MS4A7 Antibody

Images

 
Western Blot: MS4A7 Antibody [NBP1-86540] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: MS4A7 Antibody [NBP1-86540] - Staining of human appendix shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MS4A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MS4A7 Protein (NBP1-86540PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MS4A7 Antibody

  • 4SPAN2
  • CD20/FC-epsilon-RI-beta family member 4
  • CD20L4
  • CD20L4MGC22368
  • CFFM4
  • CFFM4CD20 antigen-like 4
  • CFFMA
  • Four-span transmembrane protein 2
  • high affinity immunoglobulin epsilon receptor beta subunit
  • membrane-spanning 4-domains subfamily A member 7
  • membrane-spanning 4-domains, subfamily A, member 7,4SPAN2
  • MS4A7
  • MS4A8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
AF5627
Species: Mu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-90895
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57270
Species: Hu
Applications: ICC/IF

Publications for MS4A7 Antibody (NBP1-86540) (0)

There are no publications for MS4A7 Antibody (NBP1-86540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A7 Antibody (NBP1-86540) (0)

There are no reviews for MS4A7 Antibody (NBP1-86540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A7 Antibody (NBP1-86540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A7 Products

Bioinformatics Tool for MS4A7 Antibody (NBP1-86540)

Discover related pathways, diseases and genes to MS4A7 Antibody (NBP1-86540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A7 Antibody (NBP1-86540)

Discover more about diseases related to MS4A7 Antibody (NBP1-86540).
 

Pathways for MS4A7 Antibody (NBP1-86540)

View related products by pathway.

PTMs for MS4A7 Antibody (NBP1-86540)

Learn more about PTMs related to MS4A7 Antibody (NBP1-86540).

Blogs on MS4A7

There are no specific blogs for MS4A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A7
Entrez