MS4A3 Antibody - Azide and BSA Free

Western Blot: MS4A3 Antibody [H00000932-B01P] - Analysis of MS4A3 expression in transfected 293T cell line by MS4A3 polyclonal antibody. Lane 1: MS4A3 transfected lysate(23.65 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, Flow, Func
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MS4A3 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: MS4A3 (AAH08487, 1 a.a. - 214 a.a.) full-length human protein. MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
• Specificity: MS4A3 - membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MS4A3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A3 Antibody - Azide and BSA Free

• CD20 antigen homolog
• CD20 antigen-like protein
• CD20L
• CD20LIgE receptor beta subunit
• hematopoietic cell 4 transmembrane protein
• Hematopoietic-specific transmembrane protein 4
• HTM4
• HTM4IgE receptor beta chain
• membrane-spanning 4-domains subfamily A member 3
• membrane-spanning 4-domains, subfamily A, member 3 (hematopoieticcell-specific)
• MS4A3

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MS4A3 Antibody (H00000932-B01P)(1)

Publication using H00000932-B01P

• Messingham KN, Holahan HM, Frydman AS et al. Human Eosinophils Express the High Affinity IgE Receptor, FcERI, in Bullous Pemphigoid. PLoS One. 2014-09-25 [PMID: 25255430]

Bioinformatics

• Gene Symbol: MS4A3
• Entrez:
  • 932(Human)
• Uniprot:
  • AAH08487(Human)