MRPS12 Antibody

Images

 
Western Blot: MRPS12 Antibody [NBP1-54647] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS12 Antibody Summary

Immunogen
Synthetic peptides corresponding to MRPS12(mitochondrial ribosomal protein S12) The peptide sequence was selected from the N terminal of MRPS12. Peptide sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MRPS12 and was validated on Western blot.
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRPS12 Antibody

  • 28S ribosomal protein S12, mitochondrial
  • mitochondrial ribosomal protein S12
  • MPR-S12
  • MRP-S12
  • MT-RPS12
  • ribosomal protein, mitochondrial, S12
  • RPMS12
  • RPS12
  • RPSM12S12mt

Background

Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57365
Species: Hu
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-54647
Species: Hu
Applications: WB

Publications for MRPS12 Antibody (NBP1-54647) (0)

There are no publications for MRPS12 Antibody (NBP1-54647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS12 Antibody (NBP1-54647) (0)

There are no reviews for MRPS12 Antibody (NBP1-54647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS12 Antibody (NBP1-54647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS12 Products

Bioinformatics Tool for MRPS12 Antibody (NBP1-54647)

Discover related pathways, diseases and genes to MRPS12 Antibody (NBP1-54647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS12 Antibody (NBP1-54647)

Discover more about diseases related to MRPS12 Antibody (NBP1-54647).
 

Pathways for MRPS12 Antibody (NBP1-54647)

View related products by pathway.

PTMs for MRPS12 Antibody (NBP1-54647)

Learn more about PTMs related to MRPS12 Antibody (NBP1-54647).

Blogs on MRPS12

There are no specific blogs for MRPS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS12
Uniprot