MRPL49 Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPL49 Antibody [NBP2-13618] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL49 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL49 Antibody - BSA Free (NBP2-13618) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL49
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL49 Protein (NBP2-13618PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL49 Antibody - BSA Free

• C11orf4
• L49mt39S ribosomal protein L49, mitochondrial
• mitochondrial ribosomal protein L49
• MRP-L49
• Neighbor of FAU
• next to FAU
• NOF1chromosome 11 open reading frame 4
• NOFMGC10656
• Protein NOF1

Background

MRPL49, or Mitochondrial Ribosomal Protein L49, consists of a 166 amino acid isoform that is 19 kDa, and is broadly associated with mitochondrial protein synthesis, though its specific function is still being researched. Current disease research is determining the relationship between MRPL49 and a variety of diseases and disorders, including glossopharyngeal neuralgia, osteoarthritis, ossifying fibroma, osteoporosis, and thoracic outlet syndrome. The protein has been linked to translation, and interacts with ICT1, OXA1L, SlC2A4, AARS2, and AASS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL49