MRPL49 Antibody


Immunohistochemistry-Paraffin: MRPL49 Antibody [NBP2-13618] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

MRPL49 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Specificity of human MRPL49 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL49 Protein (NBP2-13618PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPL49 Antibody

  • C11orf4
  • L49mt39S ribosomal protein L49, mitochondrial
  • mitochondrial ribosomal protein L49
  • MRP-L49
  • Neighbor of FAU
  • next to FAU
  • NOF1chromosome 11 open reading frame 4
  • NOFMGC10656
  • Protein NOF1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MRPL49 Antibody (NBP2-13618) (0)

There are no publications for MRPL49 Antibody (NBP2-13618).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL49 Antibody (NBP2-13618) (0)

There are no reviews for MRPL49 Antibody (NBP2-13618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPL49 Antibody (NBP2-13618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPL49 Products

Bioinformatics Tool for MRPL49 Antibody (NBP2-13618)

Discover related pathways, diseases and genes to MRPL49 Antibody (NBP2-13618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL49 Antibody (NBP2-13618)

Discover more about diseases related to MRPL49 Antibody (NBP2-13618).

Pathways for MRPL49 Antibody (NBP2-13618)

View related products by pathway.

Research Areas for MRPL49 Antibody (NBP2-13618)

Find related products by research area.

Blogs on MRPL49

There are no specific blogs for MRPL49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPL49 Antibody and receive a gift card or discount.


Gene Symbol MRPL49