MRPL49 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF |
| Predicted Species |
Mouse (91%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL49 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MRPL49 Antibody - BSA Free
Background
MRPL49, or Mitochondrial Ribosomal Protein L49, consists of a 166 amino acid isoform that is 19 kDa, and is broadly associated with mitochondrial protein synthesis, though its specific function is still being researched. Current disease research is determining the relationship between MRPL49 and a variety of diseases and disorders, including glossopharyngeal neuralgia, osteoarthritis, ossifying fibroma, osteoporosis, and thoracic outlet syndrome. The protein has been linked to translation, and interacts with ICT1, OXA1L, SlC2A4, AARS2, and AASS.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for MRPL49 Antibody (NBP2-13618) (0)
There are no publications for MRPL49 Antibody (NBP2-13618).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL49 Antibody (NBP2-13618) (0)
There are no reviews for MRPL49 Antibody (NBP2-13618).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MRPL49 Antibody (NBP2-13618) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL49 Products
Research Areas for MRPL49 Antibody (NBP2-13618)
Find related products by research area.
|
Blogs on MRPL49