Recombinant Human MRPL40 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPL40 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 51 of Human MRPL40 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MRPL40
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPL40 Protein

  • FLJ41774
  • L40mt
  • MGC9400
  • mitochondrial ribosomal protein L40
  • MRP-L22,39S ribosomal protein L40, mitochondrial
  • MRP-L40
  • NLVCFURIM
  • nuclear localization signal containing protein deleted in velocardiofacialsyndrome
  • nuclear localization signal deleted in velocardiofacial syndrome
  • Nuclear localization signal-containing protein deleted in velocardiofacialsyndrome
  • Up-regulated in metastasis

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Deletions in this gene may contribute to the etiology of velo-cardio-facial syndrome and DiGeorge syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-46289
Species: Hu
Applications: WB, IHC
NBP2-30404
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46261
Species: Hu
Applications: WB, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13617
Species: Hu
Applications: WB, IHC, IHC-P
H00064976-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MRPL40 Partial Recombinant Protein (H00064976-Q01) (0)

There are no publications for MRPL40 Partial Recombinant Protein (H00064976-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL40 Partial Recombinant Protein (H00064976-Q01) (0)

There are no reviews for MRPL40 Partial Recombinant Protein (H00064976-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL40 Partial Recombinant Protein (H00064976-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPL40 Products

Bioinformatics Tool for MRPL40 Partial Recombinant Protein (H00064976-Q01)

Discover related pathways, diseases and genes to MRPL40 Partial Recombinant Protein (H00064976-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL40 Partial Recombinant Protein (H00064976-Q01)

Discover more about diseases related to MRPL40 Partial Recombinant Protein (H00064976-Q01).
 

Pathways for MRPL40 Partial Recombinant Protein (H00064976-Q01)

View related products by pathway.

PTMs for MRPL40 Partial Recombinant Protein (H00064976-Q01)

Learn more about PTMs related to MRPL40 Partial Recombinant Protein (H00064976-Q01).

Blogs on MRPL40

There are no specific blogs for MRPL40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPL40 Antibody
NBP1-82620

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPL40 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL40