mitochondrial ribosomal protein L4 Antibody - BSA Free

Western Blot: mitochondrial ribosomal protein L4 Antibody [NBP2-13617] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: mitochondrial ribosomal protein L4 Antibody [NBP2-13617] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli, cytosol & endoplasmic reticulum.

Immunohistochemistry-Paraffin: mitochondrial ribosomal protein L4 Antibody [NBP2-13617] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

mitochondrial ribosomal protein L4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  mitochondrial ribosomal protein L4 Protein (NBP2-13617PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for mitochondrial ribosomal protein L4 Antibody - BSA Free

• CGI-28
• L4mt
• MGC16367
• MGC2681
• mitochondrial ribosomal protein L4,39S ribosomal protein L4, mitochondrial
• MRP-L4

Background

MRPL4, also known as 39 S ribosomal protein L4, mitochondrial, consists of a 34.9 kDa and a 29.5 kDa isoform and is involved in mitochondrial protein synthesis as a component of the 39S ribosomal subunit. Diseases and disorders such as mycobacterium tuberculosis and pneumonia are being researched with the protein. In translation pathways, the protein interacts with DDX24, EIF2B1, ICT1, KRTAP4-12, and TIMM44.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL4