mitochondrial ribosomal protein L4 Antibody

Images

 
Western Blot: mitochondrial ribosomal protein L4 Antibody [NBP2-13617] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: mitochondrial ribosomal protein L4 Antibody [NBP2-13617] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

mitochondrial ribosomal protein L4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRK VELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
mitochondrial ribosomal protein L4 Protein (NBP2-13617PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mitochondrial ribosomal protein L4 Antibody

  • CGI-28
  • L4mt
  • MGC16367
  • MGC2681
  • mitochondrial ribosomal protein L4,39S ribosomal protein L4, mitochondrial
  • MRP-L4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80054
Species: Hu
Applications: WB, IHC
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03109
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82620
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for mitochondrial ribosomal protein L4 Antibody (NBP2-13617) (0)

There are no publications for mitochondrial ribosomal protein L4 Antibody (NBP2-13617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mitochondrial ribosomal protein L4 Antibody (NBP2-13617) (0)

There are no reviews for mitochondrial ribosomal protein L4 Antibody (NBP2-13617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mitochondrial ribosomal protein L4 Antibody (NBP2-13617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mitochondrial ribosomal protein L4 Products

Bioinformatics Tool for mitochondrial ribosomal protein L4 Antibody (NBP2-13617)

Discover related pathways, diseases and genes to mitochondrial ribosomal protein L4 Antibody (NBP2-13617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mitochondrial ribosomal protein L4 Antibody (NBP2-13617)

Discover more about diseases related to mitochondrial ribosomal protein L4 Antibody (NBP2-13617).
 

Pathways for mitochondrial ribosomal protein L4 Antibody (NBP2-13617)

View related products by pathway.

PTMs for mitochondrial ribosomal protein L4 Antibody (NBP2-13617)

Learn more about PTMs related to mitochondrial ribosomal protein L4 Antibody (NBP2-13617).
 

Research Areas for mitochondrial ribosomal protein L4 Antibody (NBP2-13617)

Find related products by research area.

Blogs on mitochondrial ribosomal protein L4

There are no specific blogs for mitochondrial ribosomal protein L4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mitochondrial ribosomal protein L4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL4