MRPL50 Antibody

Western Blot: MRPL50 Antibody [NBP1-83651] - Analysis in control (vector only transfected HEK293T lysate) and MRPL50 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: MRPL50 Antibody [NBP1-83651] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MRPL50 Antibody [NBP1-83651] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MRPL50 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAERSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL50
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPL50 Protein (NBP1-83651PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL50 Antibody

• 39S ribosomal protein L50, mitochondrial
• FLJ20493
• L50mt
• mitochondrial 39S ribosomal protein L50
• mitochondrial ribosomal protein L50
• MRP-L50FLJ21990

Background

MRPL50, also known as Mitochondrial Ribosomal Protein L50, consists of a 158 amino acid isoform that is 18 kDa, and is involved in the process of synthesizing proteins within the mitochondria. There is currently no research being conducted on the relationship between MRPL50 and any diseases. The protein interacts with ICT1, AARS2, AASS, ABCB7, and ACAD9, but is not linked to any biological processes or pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL50