MRP2 Antibody

Images

 
Immunohistochemistry-Paraffin: MRP2 Antibody [NBP1-84434] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFTSITLFNILRFPLSMLPMMISSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLDIMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRP2 Protein (NBP1-84434PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRP2 Antibody

  • ATP-binding cassette, sub-family C (CFTR/MRP), member 2
  • Canalicular multidrug resistance protein
  • canalicular multispecific organic anion transporter 1
  • CMOAT1
  • CMOATABC30
  • cMRP
  • DJS
  • KIAA1010
  • MRP2ATP-binding cassette sub-family C member 2
  • Multidrug resistance-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46466
Species: Hu
Applications: IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84434
Species: Hu
Applications: IHC, IHC-P

Publications for MRP2 Antibody (NBP1-84434) (0)

There are no publications for MRP2 Antibody (NBP1-84434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP2 Antibody (NBP1-84434) (0)

There are no reviews for MRP2 Antibody (NBP1-84434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRP2 Antibody (NBP1-84434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP2 Products

MRP2 NBP1-84434

Bioinformatics Tool for MRP2 Antibody (NBP1-84434)

Discover related pathways, diseases and genes to MRP2 Antibody (NBP1-84434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP2 Antibody (NBP1-84434)

Discover more about diseases related to MRP2 Antibody (NBP1-84434).
 

Pathways for MRP2 Antibody (NBP1-84434)

View related products by pathway.

PTMs for MRP2 Antibody (NBP1-84434)

Learn more about PTMs related to MRP2 Antibody (NBP1-84434).

Blogs on MRP2

There are no specific blogs for MRP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC2