MRGX3 Antibody - BSA Free

Western Blot: MRGX3 Antibody [NBP3-09394] - Western blot analysis using NBP3-09394 on Human COLO205 as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRGX3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRGX3 Antibody - BSA Free (NBP3-09394) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MRGX3 (NP_473372). Peptide sequence FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGWL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRGPRX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRGX3 Antibody - BSA Free

• G protein-coupled receptor MRGX3
• G protein-coupled receptor SNSR2
• GPCR
• mas-related GPCR member X3
• MAS-related GPR, member X3
• mas-related G-protein coupled receptor member X3
• MRGPRX3
• MRGX3
• MRGX3G protein-coupled receptor SNSR1
• Sensory neuron-specific G-protein coupled receptor 1/2
• SNSR1
• SNSR2

Background

MRGX3 is an Orphan-A GPCR with an unknown ligand highly similar to other MRG receptors. The MRG/SNSR family has been shown to be expressed predominantly, if not solely, in subsets of dorsal root ganglion nociceptive sensory neurons. ESTs for MRGX3 have been identified in human eye libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRGPRX3