Mrc2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Mrc2 Antibody [NBP1-85768] - Analysis in human gallbladder and liver tissues using NBP1-85768 antibody. Corresponding MRC2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Mrc2 Antibody [NBP1-85768] - Staining of human Gallbladder shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Mrc2 Antibody [NBP1-85768] -Staining of human Testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: Mrc2 Antibody [NBP1-85768] - Staining of human Breast shows strong membranous positivity in myoepithelial cells.

Staining of human Liver shows very weak membranous positivity in hepatocytes.

Staining of human Placenta shows weak cytoplasmic positivity in endothelial cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mrc2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQ
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Mrc2 Protein (NBP1-85768PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Mrc2 Antibody - BSA Free

• CD280 antigen
• CD280
• CD280C-type mannose receptor 2
• CLEC13E
• CLEC13EUPAR-associated protein
• Endo180
• ENDO180C-type lectin domain family 13 member E
• Endocytic receptor 180
• KIAA0709FLJ35911
• Macrophage mannose receptor 2
• mannose receptor, C type 2
• Mrc2
• uPARAP
• UPARAPendocytic receptor (macrophage mannose receptor family)
• urokinase plasminogen activator receptor-associated protein
• Urokinase receptor-associated protein
• Urokinase-type plasminogen activator receptor-associated protein

Background

MRC2, also known as C-type mannose receptor 2, is a 1,479 amino acid protein that is 167 kDa, plays a role in extracellular matrix remodeling by mediating the internalization and lysosomal degradation of collagen ligands, may be involved in plasminogen activation system controlling the extracellular level of PLAUR/PLAU, and thus may regulate protease activity at the cell surface, and may play a role in the tumorigenesis and metastasis of several malignancies including breast cancer, gliomas and metastatic bone disease. Disease research is currently being studied with relations to MRC2 and breast cancer, aortic aneurysm, prostate cancer, progression of osteoarthritis, prostatitis,s, schizophrenia, tuberculosis, immunodeficiency, and hepatitis. Interactions with this protein have shown to involve NDEL1, IL10, TGFB1, TGFB2, TGFB3, and UBC in antigen processing-cross presentation, cross-presentation of soluble exogenous antigens (endosomes), adaptive immune system, class I MHC mediated antigen processing & presentation, immune system, phagosome, and tuberculosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRC2
• Entrez:
  • 9902(Human)
• Uniprot:
  • Q9UBG0()