MPV17L Antibody


Western Blot: MPV17L Antibody [NBP1-56328] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MPV17L Antibody Summary

Synthetic peptides corresponding to MPV17L(MPV17 mitochondrial membrane protein-like) The peptide sequence was selected from the N terminal of MPV17L. Peptide sequence MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MPV17L and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MPV17L Antibody

  • FLJ39599
  • MGC70356
  • M-LP homolog
  • M-LPH
  • MLPH1
  • MLPH2
  • MPV17 mitochondrial membrane protein-like
  • MPV17L1
  • Mpv17-like protein type 1
  • Mpv17-like protein type 2
  • mpv17-like protein


Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA

Publications for MPV17L Antibody (NBP1-56328) (0)

There are no publications for MPV17L Antibody (NBP1-56328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPV17L Antibody (NBP1-56328) (0)

There are no reviews for MPV17L Antibody (NBP1-56328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPV17L Antibody (NBP1-56328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MPV17L Products

Bioinformatics Tool for MPV17L Antibody (NBP1-56328)

Discover related pathways, diseases and genes to MPV17L Antibody (NBP1-56328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPV17L Antibody (NBP1-56328)

Discover more about diseases related to MPV17L Antibody (NBP1-56328).

Pathways for MPV17L Antibody (NBP1-56328)

View related products by pathway.

PTMs for MPV17L Antibody (NBP1-56328)

Learn more about PTMs related to MPV17L Antibody (NBP1-56328).

Blogs on MPV17L

There are no specific blogs for MPV17L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MPV17L Antibody and receive a gift card or discount.


Gene Symbol MPV17L