Recombinant Human mpp8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human mpp8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 442-549 of Human HSMPP8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MPHOSPH8
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human mpp8 Protein

  • FLJ35237
  • HSMPP8
  • M-phase phosphoprotein 8
  • M-phase phosphoprotein, mpp
  • M-phase phosphoprotein, mpp8
  • mpp8
  • TWA3
  • Two hybrid-associated protein 3 with RanBPM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB100-2436
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20116
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP2-20322
Species: Hu
Applications: WB, ChIP, IP
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80655
Species: Hu
Applications: IHC, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P

Publications for mpp8 Partial Recombinant Protein (H00054737-Q01) (0)

There are no publications for mpp8 Partial Recombinant Protein (H00054737-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mpp8 Partial Recombinant Protein (H00054737-Q01) (0)

There are no reviews for mpp8 Partial Recombinant Protein (H00054737-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mpp8 Partial Recombinant Protein (H00054737-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional mpp8 Products

Bioinformatics Tool for mpp8 Partial Recombinant Protein (H00054737-Q01)

Discover related pathways, diseases and genes to mpp8 Partial Recombinant Protein (H00054737-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for mpp8 Partial Recombinant Protein (H00054737-Q01)

Find related products by research area.

Blogs on mpp8

There are no specific blogs for mpp8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
mpp8 Antibody
NBP1-92135

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human mpp8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MPHOSPH8