MPDU1 Antibody - BSA Free

Western Blot: MPDU1 Antibody [NBP2-83222] - Host: Rabbit. Target Name: MPDU1. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MPDU1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MPDU1 Antibody - BSA Free (NBP2-83222) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPDU1. Peptide sequence: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPDU1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MPDU1 Antibody - BSA Free

• CDGIF
• FLJ14836
• HBeAg-binding protein 2 binding protein A
• Lec35
• mannose-P-dolichol utilization defect 1 protein
• mannose-P-dolichol utilization defect 1
• My008
• PP3958
• PQLC5
• SL15HBEBP2BPA
• Suppressor of Lec15 and Lec35 glycosylation mutation homolog

Background

MPDU1 encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPDU1