MP1/MAP2K1IP1 Antibody

Images

 
Western Blot: MP1/MAP2K1IP1 Antibody [NBP1-87837] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry: MAP2K1IP1/MAPKSP1 Antibody [NBP1-87837] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MP1/MAP2K1IP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMTOR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
MP1/MAP2K1IP1 Protein (NBP1-87837PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MP1/MAP2K1IP1 Antibody

  • LAMTOR3
  • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
  • MAP2K1IP1
  • Mapbp
  • MAPK scaffold protein 1
  • MAPKSP1
  • MEK binding partner 1
  • MEK partner 1
  • MEK-binding partner 1
  • mitogen-activated protein kinase kinase 1 interacting protein 1
  • Mitogen-activated protein kinase kinase 1-interacting protein 1
  • Mitogen-activated protein kinase scaffold protein 1
  • MP1
  • PRO0633
  • Ragulator3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MP1/MAP2K1IP1 Antibody (NBP1-87837) (0)

There are no publications for MP1/MAP2K1IP1 Antibody (NBP1-87837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MP1/MAP2K1IP1 Antibody (NBP1-87837) (0)

There are no reviews for MP1/MAP2K1IP1 Antibody (NBP1-87837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MP1/MAP2K1IP1 Antibody (NBP1-87837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MP1/MAP2K1IP1 Products

Bioinformatics Tool for MP1/MAP2K1IP1 Antibody (NBP1-87837)

Discover related pathways, diseases and genes to MP1/MAP2K1IP1 Antibody (NBP1-87837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MP1/MAP2K1IP1 Antibody (NBP1-87837)

Discover more about diseases related to MP1/MAP2K1IP1 Antibody (NBP1-87837).
 

Pathways for MP1/MAP2K1IP1 Antibody (NBP1-87837)

View related products by pathway.

PTMs for MP1/MAP2K1IP1 Antibody (NBP1-87837)

Learn more about PTMs related to MP1/MAP2K1IP1 Antibody (NBP1-87837).
 

Research Areas for MP1/MAP2K1IP1 Antibody (NBP1-87837)

Find related products by research area.

Blogs on MP1/MAP2K1IP1

There are no specific blogs for MP1/MAP2K1IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MP1/MAP2K1IP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMTOR3
Entrez