MOX1 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

MOX1 Recombinant Protein Summary

Description
MOX1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
MEOX1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOX1 Recombinant Protein

  • homeobox protein MOX-1
  • mesenchyme homeobox 1MOX1mesenchyme homeo box 1

Background

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: WB, ICC, ICFlow
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-874
Species: Hu, Pm
Applications: WB, ELISA, IHC, IHC-P, Flow-IC
H00005075-R01
Species: Hu
NB100-1268
Species: Hu, Mu, Ze
Applications: WB, ChIP, IHC, IHC-P, PEP-ELISA
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB100-56726
Species: Hu, Ca
Applications: B/N, Flow, ICC/IF, IP, In vitro, Flow-CS, Flow-IC
MAB27591
Species: Mu
Applications: Flow, ICC

Publications for MOX1 Recombinant Protein (H00004222-P01) (0)

There are no publications for MOX1 Recombinant Protein (H00004222-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOX1 Recombinant Protein (H00004222-P01) (0)

There are no reviews for MOX1 Recombinant Protein (H00004222-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOX1 Recombinant Protein (H00004222-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOX1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for MOX1 Recombinant Protein (H00004222-P01)

Discover related pathways, diseases and genes to MOX1 Recombinant Protein (H00004222-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOX1 Recombinant Protein (H00004222-P01)

Discover more about diseases related to MOX1 Recombinant Protein (H00004222-P01).
 

Pathways for MOX1 Recombinant Protein (H00004222-P01)

View related products by pathway.

Blogs on MOX1

There are no specific blogs for MOX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MEOX1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00004222-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

MOX1 Antibody
NBP1-92134
MOX1 Antibody
NBP1-92134
MOX1 Antibody
NBP1-92134