MOS Antibody

Images

 
Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in human pancreas.
Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in transfected 293T cell line by MOS polyclonal antibody.Lane 1: MOS transfected lysate(37.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOS Antibody Summary

Immunogen
MOS (NP_005363.1, 1 a.a. - 346 a.a.) full-length human protein. MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
Specificity
Reacts with v-mos Moloney murine sarcoma viral oncogene homolog.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOS Antibody

  • c-mos
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC119962
  • MGC119963
  • MSV
  • oncogene MOS, Moloney murine sarcoma virus
  • Oocyte maturation factor mos
  • Proto-oncogene c-Mos
  • proto-oncogene serine/threonine-protein kinase mos
  • v-mos Moloney murine sarcoma viral oncogene homolog

Background

MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-79724
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF5414
Species: Hu
Applications: Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
H00004342-D01P
Species: Hu
Applications: WB

Publications for MOS Antibody (H00004342-D01P) (0)

There are no publications for MOS Antibody (H00004342-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOS Antibody (H00004342-D01P) (0)

There are no reviews for MOS Antibody (H00004342-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOS Antibody (H00004342-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOS Products

Array H00004342-D01P

Bioinformatics Tool for MOS Antibody (H00004342-D01P)

Discover related pathways, diseases and genes to MOS Antibody (H00004342-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOS Antibody (H00004342-D01P)

Discover more about diseases related to MOS Antibody (H00004342-D01P).
 

Pathways for MOS Antibody (H00004342-D01P)

View related products by pathway.

PTMs for MOS Antibody (H00004342-D01P)

Learn more about PTMs related to MOS Antibody (H00004342-D01P).
 

Research Areas for MOS Antibody (H00004342-D01P)

Find related products by research area.

Blogs on MOS

There are no specific blogs for MOS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOS
Entrez
Uniprot