MORF4L2 Antibody

Images

 
Western Blot: MORF4L2 Antibody [NBP2-47370] - Analysis in control (vector only transfected HEK293T lysate) and MORF4L2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: MORF4L2 Antibody [NBP2-47370] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells with additional cytoplasmic staining in endothelial cells and peripheral ...read more
Genetic Strategies: Western Blot: MORF4L2 Antibody [NBP2-47370] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

MORF4L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK
Specificity
Specificity of human MORF4L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORF4L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MORF4L2 Protein (NBP2-47370PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MORF4L2 Antibody

  • KIAA0026MRGXProtein MSL3-2
  • MORFL2
  • MORF-related gene X protein
  • mortality factor 4 like 2
  • mortality factor 4-like protein 2
  • MSL3-2 protein
  • Transcription factor-like protein MRGX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1307
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00004605-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-67460
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-20127
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB110-75035
Species: Hu, Mu, Ha(-)
Applications: WB, ICC/IF, IHC, KD, Single-Cell Western
NBP3-02990
Species: Hu, Mu, Rt
Applications: WB
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98552
Species: Hu
Applications: WB
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NB100-360
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
MAB2695
Species: Hu
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for MORF4L2 Antibody (NBP2-47370) (0)

There are no publications for MORF4L2 Antibody (NBP2-47370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORF4L2 Antibody (NBP2-47370) (0)

There are no reviews for MORF4L2 Antibody (NBP2-47370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MORF4L2 Antibody (NBP2-47370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MORF4L2 Products

Bioinformatics Tool for MORF4L2 Antibody (NBP2-47370)

Discover related pathways, diseases and genes to MORF4L2 Antibody (NBP2-47370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORF4L2 Antibody (NBP2-47370)

Discover more about diseases related to MORF4L2 Antibody (NBP2-47370).
 

Pathways for MORF4L2 Antibody (NBP2-47370)

View related products by pathway.

PTMs for MORF4L2 Antibody (NBP2-47370)

Learn more about PTMs related to MORF4L2 Antibody (NBP2-47370).

Blogs on MORF4L2

There are no specific blogs for MORF4L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORF4L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MORF4L2