MORC2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining in human testis and pancreas tissues using anti-MORC2 antibody. Corresponding MORC2 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: MORC2 Antibody [NBP1-89295] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MORC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSECLRIEPDTTALSTNHETIDLLVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAKASEESLRTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIED
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MORC2 Protein (NBP1-89295PEP)
Publications
Read Publications using
NBP1-89295 in the following applications:

  • IHC
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MORC2 Antibody

  • AC004542.C22.1
  • KIAA0852
  • MORC family CW-type zinc finger 2
  • MORC family CW-type zinc finger protein 2
  • ZCW3
  • ZCWCC1
  • Zinc finger CW-type coiled-coil domain protein 1
  • zinc finger, CW type with coiled-coil domain 1
  • zinc finger, CW-type with coiled-coil domain 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
NBP2-22151
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-98518
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32395
Species: Hu
Applications: IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-61796
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-91154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005058-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-89295
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MORC2 Antibody (NBP1-89295)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MORC2 Antibody (NBP1-89295) (0)

There are no reviews for MORC2 Antibody (NBP1-89295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MORC2 Antibody (NBP1-89295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MORC2 Products

Bioinformatics Tool for MORC2 Antibody (NBP1-89295)

Discover related pathways, diseases and genes to MORC2 Antibody (NBP1-89295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORC2 Antibody (NBP1-89295)

Discover more about diseases related to MORC2 Antibody (NBP1-89295).
 

Pathways for MORC2 Antibody (NBP1-89295)

View related products by pathway.

PTMs for MORC2 Antibody (NBP1-89295)

Learn more about PTMs related to MORC2 Antibody (NBP1-89295).
 

Research Areas for MORC2 Antibody (NBP1-89295)

Find related products by research area.

Blogs on MORC2

There are no specific blogs for MORC2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MORC2