MORC2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining in human testis and pancreas tissues using anti-MORC2 antibody. Corresponding MORC2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: MORC2 Antibody [NBP1-89295] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: MORC2 Antibody [NBP1-89295] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MORC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MORC2 Antibody - BSA Free (NBP1-89295) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-MORC2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSECLRIEPDTTALSTNHETIDLLVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAKASEESLRTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIED
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MORC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MORC2 Protein (NBP1-89295PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MORC2 Antibody - BSA Free

• AC004542.C22.1
• KIAA0852
• MORC family CW-type zinc finger 2
• MORC family CW-type zinc finger protein 2
• ZCW3
• ZCWCC1
• Zinc finger CW-type coiled-coil domain protein 1
• zinc finger, CW type with coiled-coil domain 1
• zinc finger, CW-type with coiled-coil domain 1

Background

MORC2 is a zinc-finger CW-type coil-coiled domain 1 protien. In humans it is mapped to chromosome 22q12.2. It is highly expressed in smooth muscle, pancreas and testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MORC2 Antibody (NBP1-89295)(4)

Publications using NBP1-89295

• He J, Liao XH, Zhong BD et Al. Association of MORC2 expression with progression-free survival in cervical cancer patients treated with concurrent chemoradiotherapy Medicine (Baltimore) 2024-09-20 [PMID: 39312367]
• Liao X, Liu C, Ding Z et al. High expression of MORC2 predicts worse neoadjuvant chemotherapy efficacy in triple negative breast cancer Medicine 2023-06-23 [PMID: 37352040] (IHC, Human)
• Yang F, Sun R, Hou Z et al. HSP90 N-terminal inhibitors target oncoprotein MORC2 for autophagic degradation and suppress MORC2-driven breast cancer progression Clinical and translational medicine 2022-05-01 [PMID: 35522895] (IF/IHC, Mouse)
• Liu YY, Liu HY, Yu TJ et al. O-GlcNAcylation of MORC2 at threonine 556 by OGT couples TGF-beta signaling to breast cancer progression Cell death and differentiation 2022-01-01 [PMID: 34974534] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MORC2