MOBKL3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MOBKL3 Antibody - BSA Free (NBP2-83217) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MOBKL3. Peptide sequence: MDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELN The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MOB4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MOBKL3 Antibody - BSA Free
Background
MOBKL3 was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for MOBKL3 Antibody (NBP2-83217) (0)
There are no publications for MOBKL3 Antibody (NBP2-83217).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MOBKL3 Antibody (NBP2-83217) (0)
There are no reviews for MOBKL3 Antibody (NBP2-83217).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MOBKL3 Antibody (NBP2-83217) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MOBKL3 Products
Research Areas for MOBKL3 Antibody (NBP2-83217)
Find related products by research area.
|
Blogs on MOBKL3